Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial

1-61aa

Dodatkowe informacje:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Specyfikacja/Zawartość:

MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC

Wysyłka i przechowywanie:

Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.

Inne:

For research use only.