Recombinant Mouse Beta-synuclein (Sncb)

Recombinant Mouse Beta-synuclein (Sncb)

Numer katalogowy: 399-1-CSB-EP838720MO

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

Cusabio Gentaur

Rozmiar/Cena:
10ug - 0.00 PLN* Zapytaj o cenę
50ug - 0.00 PLN* Zapytaj o cenę
100ug - 0.00 PLN* Zapytaj o cenę
200ug - 0.00 PLN* Zapytaj o cenę
500ug - 0.00 PLN* Zapytaj o cenę
1MG - 0.00 PLN* Zapytaj o cenę
* Cena orientacyjna netto, zawierająca również szacunkowy koszt transportu. Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

1-133aa

Dodatkowe informacje:


Tag-Free

Specyfikacja/Zawartość:


MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA

Wysyłka i przechowywanie:


Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.

Inne:


For research use only.

0 opinie o Recombinant Mouse Beta-synuclein (Sncb)

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345