Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)
Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne
Sprzedawca:Gentaur
23-245aa
Dodatkowe informacje:
N-terminal 6xHis-SUMO-tagged
Specyfikacja/Zawartość:
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Wysyłka i przechowywanie:
Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Inne:
For research use only.
0 opinie o Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)