Syntaxin-8 Recombinant Protein

Syntaxin-8 Recombinant Protein

Numer katalogowy: 223-92-190

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

ProSci Gentaur

Rozmiar: 0.05 mg
Dostępność: Na zamówienie
Cena: 0.01 PLN*
Syntaxin-8 Recombinant Protein
Syntaxin-8 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

Inquiry cart
1
Adres Email: | Edit
2
Szczegóły zapytania
Syntaxin-8 Recombinant Protein
Syntaxin-8 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

3
Inquiry cart
* Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

Syntaxin-8 is a single-pass type IV membrane protein which belongs to the syntaxin family. It contains one t-SNARE coil homology domain. STX8 is highly expressed in heart, also found in brain, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas. STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis. It as a vesicle trafficking protein functions in the early secretory pathway, possibly mediating retrograde transport form cis-golgi membrane to the ER.

Specyfikacja/Zawartość:


  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 24.6 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl,pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: STX8
  • Accession #: Q9UNK0
  • Protein GI: N/A
  • NCBI gene ID#: 9482
  • NCBI official full name: syntaxin 8
  • NCBI organism: Homo sapiens
  • Peptide sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
  • SWISSPROT #: Q9UNK0
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: E. coli
  • Species: Human
  • By Source: E. Coli
  • By Species: Human
  • Fusion tag: Tag Free
  • Sequence: Met1-Gly215
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:


Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:


Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 opinie o Syntaxin-8 Recombinant Protein

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345