Cyclophilin E Recombinant Protein

Peptidyl-prolyl cis-trans isomerase E, also known as Cyclophilin E, Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily. PPIE found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. PPIE contains one PPIase cyclophilin-type domain and one RRM (RNA recognition motif) domain. PPIE accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIE combines RNA-binding and PPIase activities. It may be involved in muscle- and brain-specific processes and pre-mRNA splici

Specyfikacja/Zawartość:

• Tested Applications: N/A
• Applications: This recombinant protein can be used for biological assays. For research use only.
• Predicted Molecular Weight: 35.6 kD
• Physical state: Liquid
• Buffer: Supplied as a 0.2 um filtered solution of 20mM TrisHCl, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
• Concentration: N/A
• NCBI official symbol: PPIE
• Accession #: Q9UNP9
• Protein GI: N/A
• NCBI gene ID#: 10450
• NCBI official full name: peptidylprolyl isomerase E
• NCBI organism: Homo sapiens
• Peptide sequence: MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
• SWISSPROT #: Q9UNP9
• Background Reference 1: N/A
• Background Reference 2: N/A
• Background Reference 3: N/A
• Background Reference 4: N/A
• Background Reference 5: N/A
• Source: E. coli
• Species: Human
• By Source: E. Coli
• By Species: Human
• Fusion tag: N-6 His tag
• Sequence: Met1-Val301
• Biology activity: N/A
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
  Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:

Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Inne:

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.