CCL5 Recombinant Protein

Human Chemokine (C-C Motif) Ligand 5 (CCL5) plays an active role in recruiting leukocytes into inflammatory sites. CCL5 is secreted by many cell types at inflammatory sites and it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, and CCR5. N-Terminal truncated CCL5/RANTES, Met-RANTES, and amino-oxypentane (AOP)-RANTES exhibit antagonist or partial agonist functions on their receptors. CCL5/RANTES attracts different subtypes of leukocytes into inflamed tissue and intervenes in a wide range of allergic and autoimmune diseases.

Specyfikacja/Zawartość:

• Tested Applications: N/A
• Applications: This recombinant protein can be used for biological assays. For research use only.
• Predicted Molecular Weight: 7.8 kD
• Physical state: Lyophilized
• Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
• Concentration: N/A
• NCBI official symbol: CCL5
• Accession #: P13501
• Protein GI: 189054143
• NCBI gene ID#: 6352
• NCBI official full name: C-C motif chemokine ligand 5
• NCBI organism: Homo sapiens
• Peptide sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
• SWISSPROT #: P13501
• Background Reference 1: N/A
• Background Reference 2: N/A
• Background Reference 3: N/A
• Background Reference 4: N/A
• Background Reference 5: N/A
• Source: E. coli
• Species: Human
• By Source: E. Coli
• By Species: Human
• Fusion tag: Tag Free
• Sequence: Ser24-Ser91
• Biology activity: N/A
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
  Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.