Host cell factor 2 Recombinant Protein

Host cell factor 2(HCFC2) is a cytoplasmic protein. It contains 2 fibronectin type-III domains.HCFC2 binds KMT2A/MLL1, as component of the MLL1/MLL complex.Hcfc2 negative regulation of transcription from RNA polymerase II promoter.

Specyfikacja/Zawartość:

• Tested Applications: N/A
• Applications: This recombinant protein can be used for biological assays. For research use only.
• Predicted Molecular Weight: 55.2 kD
• Physical state: Liquid
• Buffer: Supplied as a 0.2 um filtered solution of PBS,2MUrea,pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
• Concentration: N/A
• NCBI official symbol: Hcfc2
• Accession #: Q9D968
• Protein GI: N/A
• NCBI gene ID#: 67933
• NCBI official full name: host cell factor C2
• NCBI organism: Mus musculus
• Peptide sequence: MNHKVHHHHHHMAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE
• SWISSPROT #: Q9D968
• Background Reference 1: N/A
• Background Reference 2: N/A
• Background Reference 3: N/A
• Background Reference 4: N/A
• Background Reference 5: N/A
• Source: E. coli
• Species: Mouse
• By Source: E. Coli
• By Species: Mouse
• Fusion tag: N-6 His tag
• Sequence: Met1-Glu497
• Biology activity: N/A
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
  Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:

Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Inne:

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.