HTRA2 Recombinant Protein

HTRA2 Recombinant Protein

Numer katalogowy: 223-91-602

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

ProSci Gentaur

Rozmiar: 0.05 mg
Dostępność: Na zamówienie
Cena: 0.01 PLN*
HTRA2 Recombinant Protein
HTRA2 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

Inquiry cart
1
Adres Email: | Edit
2
Szczegóły zapytania
HTRA2 Recombinant Protein
HTRA2 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

3
Inquiry cart
* Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

High temperature requirement protein A2(HTRA2) is a single-pass membrane protein .It contains 1 PDZ (DHR) domain and belongs to the peptidase S1C family. HtrA2 can be released from the mitochondria during apoptosis and uses its four most N-terminal amino acids to mimic a caspase and be recruited by IAP caspase inhibitors such as XIAP and CIAP1/2. It promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. The protein cleaves THAP5 and promotes its degradation during apoptosis.

Specyfikacja/Zawartość:


  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 36 kD
  • Physical state: Liquid
  • Buffer: Supplied as a 0.2 um filtered solution of 20mM Tris,150mM NaCl,pH7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
  • Concentration: N/A
  • NCBI official symbol: HTRA2
  • Accession #: O43464
  • Protein GI: N/A
  • NCBI gene ID#: 27429
  • NCBI official full name: HtrA serine peptidase 2
  • NCBI organism: Homo sapiens
  • Peptide sequence: AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTEVDHHHHHH
  • SWISSPROT #: O43464
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Ala134-Glu458
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:


Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Inne:


Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 opinie o HTRA2 Recombinant Protein

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345