CLEC4E Recombinant Protein

C-Type Lectin Domain Family 4 Member E (CLEC4E) is a 219 amino acid single-pass type II membrane protein that contains one C-type Lectin domain. It is expressed in monocytes, CLEC4E functions as a downstream target of C/EBP beta and is thought to play a role in the inflammatory response, possibly via transcriptional control of C/EBP beta . CLEC4E may play a role in the response to inflammatory stimuli in peritoneal macrophages and may be involved in immune surveillance processes under transcriptional control of CEBPB. Human CLEC4E shares 67% sequence identity with its mouse counterpart, suggesting a similar function between species. CLEC-4E exists as multiple alternatively spliced isoforms that are encoded by a gene which maps to a natural killer gene complex region on human chromosome 12.

Specyfikacja/Zawartość:

• Tested Applications: N/A
• Applications: This recombinant protein can be used for biological assays. For research use only.
• Predicted Molecular Weight: 21.7 kD
• Physical state: Lyophilized
• Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
• Concentration: N/A
• NCBI official symbol: CLEC4E
• Accession #: Q9ULY5
• Protein GI: N/A
• NCBI gene ID#: 26253
• NCBI official full name: C-type lectin domain family 4 member E
• NCBI organism: Homo sapiens
• Peptide sequence: RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSLVDHHHHHH
• SWISSPROT #: Q9ULY5
• Background Reference 1: N/A
• Background Reference 2: N/A
• Background Reference 3: N/A
• Background Reference 4: N/A
• Background Reference 5: N/A
• Source: Human Cells
• Species: Human
• By Source: Human Cells
• By Species: Human
• Fusion tag: C-6 His tag
• Sequence: Arg41-Leu219
• Biology activity: N/A
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
  Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.