Complement factor D Recombinant Protein

Complement factor D Recombinant Protein

Numer katalogowy: 223-92-692

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

ProSci Gentaur

Rozmiar: 0.05 mg
Dostępność: Na zamówienie
Cena: 0.01 PLN*
Complement factor D Recombinant Protein
Complement factor D Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

Inquiry cart
1
Adres Email: | Edit
2
Szczegóły zapytania
Complement factor D Recombinant Protein
Complement factor D Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

3
Inquiry cart
* Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

Complement factor D, also known as adipsin, is a member of the chymotrypsin family of serine proteases, which plays an essential role in host defense as the rate-limiting enzyme in the alternative pathway of complement activation. Complement factor D activates a convertase (C3bBb) responsible for cleavage of the complement protein C3, which leads to the activation of terminal complement component C5-9 to form the membrane attack complex on microbial or cellular surfaces. It also functions in the regulation of systemic energy balance and physiologic and pathologic processes, including immunity and inflammation.

Specyfikacja/Zawartość:


  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 26.8 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mMTris,150mMNaCl,pH7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: Cfd
  • Accession #: P03953
  • Protein GI: N/A
  • NCBI gene ID#: 11537
  • NCBI official full name: complement factor D (adipsin)
  • NCBI organism: Mus musculus
  • Peptide sequence: ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTSHHHHHHHHHH
  • SWISSPROT #: P03953
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Mouse
  • By Source: Human Cells
  • By Species: Mouse
  • Fusion tag: C-10 His tag
  • Sequence: Ile26-Ser259
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:


Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:


Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 opinie o Complement factor D Recombinant Protein

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345