CDK2AP2 Recombinant Protein

CDK2AP2, also known as DOC1R, is short for cyclin-dependent kinase 2-associated protein 2. The gene CDK2AP2 encodes this protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. It belongs to the CDK2AP family. CDK2AP1 (cyclin-dependent kinase 2-associated protein 1), corresponding to the gene doc-1 (deleted in oral cancer 1), is a tumor suppressor protein. The doc-1 gene is absent or down-regulated in hamster oral cancer cells and in many other cancer cell types. The ubiquitously expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G(1)-to-S phase transition.

Specyfikacja/Zawartość:

• Tested Applications: N/A
• Applications: This recombinant protein can be used for biological assays. For research use only.
• Predicted Molecular Weight: 14.1 kD
• Physical state: Lyophilized
• Buffer: Lyophilized from a 0.2 um filtered solution of PBS,pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
• Concentration: N/A
• NCBI official symbol: CDK2AP2
• Accession #: O75956
• Protein GI: N/A
• NCBI gene ID#: 10263
• NCBI official full name: cyclin-dependent kinase 2 associated protein 2
• NCBI organism: Homo sapiens
• Peptide sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNARTVDHHHHHH
• SWISSPROT #: O75956
• Background Reference 1: N/A
• Background Reference 2: N/A
• Background Reference 3: N/A
• Background Reference 4: N/A
• Background Reference 5: N/A
• Source: Human Cells
• Species: Human
• By Source: Human Cells
• By Species: Human
• Fusion tag: C-6 His tag
• Sequence: Met1-Thr126
• Biology activity: N/A
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
  Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.