BCAS2 Recombinant Protein

BCAS2 Recombinant Protein

Numer katalogowy: 223-92-031

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

ProSci Gentaur

Rozmiar: 0.05 mg
Dostępność: Na zamówienie
Cena: 0.01 PLN*
BCAS2 Recombinant Protein
BCAS2 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

Inquiry cart
1
Adres Email: | Edit
2
Szczegóły zapytania
BCAS2 Recombinant Protein
BCAS2 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

3
Inquiry cart
* Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

Breast Carcinoma-Amplified Sequence 2 (BCAS2) is a member of the SPF27 family. BCAS2 is a nuclear protein and widely expressed in many rtissues. BCAS2 is identified as being overexpressed in various breast cancer cell lines. BCAS2 is a component of the spliceosome, taking part in the removal of introns from mRNA precursors. BCAS2 interacts with estrogen receptor alpha and beta, thyroid hormone receptor beta, peroxisome proliferator-activated receptor gamma. BCAS2 functions as an ER co-activator and is capable of enhancing ER-mediated transcription.

Specyfikacja/Zawartość:


  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 28.58 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 200mM NaCl, 2mM DTT, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: BCAS2
  • Accession #: O75934
  • Protein GI: N/A
  • NCBI gene ID#: 10286
  • NCBI official full name: breast carcinoma amplified sequence 2
  • NCBI organism: Homo sapiens
  • Peptide sequence: MASMTGGQQMGRGSMAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDFLEHHHHHH
  • SWISSPROT #: O75934
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: E. coli
  • Species: Human
  • By Source: E. Coli
  • By Species: Human
  • Fusion tag: C-6 His, N-T7 tag
  • Sequence: Ala2-Phe225
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:


Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:


Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 opinie o BCAS2 Recombinant Protein

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345