Recombinant Mouse Prohibitin (Phb), partial

Recombinant Mouse Prohibitin (Phb), partial

Numer katalogowy: 399-CSB-EP017885MO1-1MG

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

Cusabio Gentaur

Rozmiar: 1MG
Dostępność: Dostępny
Cena: 1357.50 PLN*
Recombinant Mouse Prohibitin (Phb), partial
Recombinant Mouse Prohibitin (Phb), partial

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

Inquiry cart
1
Adres Email: | Edit
2
Szczegóły zapytania
Recombinant Mouse Prohibitin (Phb), partial
Recombinant Mouse Prohibitin (Phb), partial

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

3
Inquiry cart
* Cena orientacyjna netto, zawierająca również szacunkowy koszt transportu. Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

1-40aa

Dodatkowe informacje:


N-terminal 6xHis-tagged

Specyfikacja/Zawartość:


MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD

Wysyłka i przechowywanie:


Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.

Inne:


For research use only.

0 opinie o Recombinant Mouse Prohibitin (Phb), partial

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345