Recombinant Human Complement component C8 gamma chain (C8G)

Recombinant Human Complement component C8 gamma chain (C8G)

Numer katalogowy: 399-CSB-BP004196HU-100ug

Kategoria produktu: Biznes i przemysł > Badania naukowe i laboratoryjne

Sprzedawca:

Cusabio Gentaur

Rozmiar: 100ug
Dostępność: Dostępny
Cena: 1357.50 PLN*
Recombinant Human Complement component C8 gamma chain (C8G)
Recombinant Human Complement component C8 gamma chain (C8G)

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

Inquiry cart
1
Adres Email: | Edit
2
Szczegóły zapytania
Recombinant Human Complement component C8 gamma chain (C8G)
Recombinant Human Complement component C8 gamma chain (C8G)

Numer kat.: / Rozmiar: / Cena: PLN (bez podatku VAT)

3
Inquiry cart
* Cena orientacyjna netto, zawierająca również szacunkowy koszt transportu. Zapytaj o ofertę, aby otrzymać aktualną ofertę w 24h.

21-202aa

Dodatkowe informacje:


N-terminal 10xHis-tagged

Specyfikacja/Zawartość:


QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Wysyłka i przechowywanie:


Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.

Inne:


For research use only.

0 opinie o Recombinant Human Complement component C8 gamma chain (C8G)

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345