Serpin B3 Recombinant Protein

Serpin B3 Recombinant Protein

Numer katalogowy: 223-92-461
Sprzedawca:

ProSci Gentaur

Rozmiar: 0.05 mg
Cena: 3860.58 PLN*
Lorem ipsum asdokfopdskaf
Serpin B3 Recombinant Protein
Serpin B3 Recombinant Protein

Numer kat.: / Rozmiar: / Cena: PLN

* Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami, aby otrzymać aktualną ofertę.

Opis Produktu:


Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene, belongs to the serpin family, Ov-serpin subfamily, May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).

Specyfikacja/Zawartość:


  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 45.96 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of PBS,pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: SERPINB3
  • Accession #: P29508
  • Protein GI: N/A
  • NCBI gene ID#: 6317
  • NCBI official full name: serpin peptidase inhibitor, clade B (ovalbumin), member 3
  • NCBI organism: Homo sapiens
  • Peptide sequence: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSPVDHHHHHH
  • SWISSPROT #: P29508
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Met1-Pro390
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:


Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:


Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

0 opinie o Serpin B3 Recombinant Protein

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345

Accu-tell COVID-19 igg igm rapid test kasetkowy osocze krew koronawirus

Accu-Tell® COVID-19 IgG/IgM to szybki test kasetkowy (krew pełna / surowica / osocze)

Accu-Tell® COVID-19 to szybki chromatograficzny teste immunologicznym do jakościowego wykrywania przeciwciał IgG i IgM przeciwko SARS-CoV-2 w ludzkiej krwi pełnej, surowicy lub osoczu, jako wsparcie w diagnostyce pierwotnych i wtórnych zakażeń SARS-Cov-2. Test rekacji łańcuchowej polimerazy wykorzystujący kwas nukleinowy - (PCR) jest powszenie uznawanym standardem w diagnozowaniu choroby COVID-19. Jednak obecnie test PCR ma problem…
Kit do badania N-acetylocysteiny od BioVision

Kit do badania N-acetylocysteiny od BioVision

N-acetylocysteina (NAC) jest prekursorem biosyntezy L-cysteiny i glutationu. Jest silnym przeciwutleniaczem i substancją usuwającą wolne rodniki. Jest powszechnie stosowany w leczeniu kaszlu, grypy, suchego oka, chorób płuc, zatrucia paracetamolem itp. Ponadto w ostatnich badaniach zbadano korzystne działanie NAC w cukrzycy typu 2 i zaburzeniach psychicznych. NAC jest dostępny bez recepty w tabletkach, roztworach oraz preparatach…
czym jest- koronawirus covid-19 corona virus

Koronawirus (COVID-19) – Co musisz wiedzieć?

Koronawirus jest nowym szczepem wirusa oddechowego, który wchodzi w skład dużej rodziny wirusów. Wirus ten powoduje chorobę, która obejmuje zarówno przeziębienie, jak i cięższy zespół oddechowy. Na Bliskim Wschodzie (MERS-CoV) i zespół ciężkiej ostrej niewydolności oddechowej (SARS-CoV). Koronawirus jest największą grupą wirusów należących do rzędu Nidovirales, które obejmują rodziny Coronaviridae, Arteriviridae i Roniviridae. Coronaviridae ma…
Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1