Serpin A1c Recombinant Protein

Alpha-1-antitrypsin 1-3(SERPIN A1) is a secreted protein and belongs to the serpin family. Serpins bind the protease active site resulting in a major conformational rearrangement that traps the enzyme in a covalent acyl-enzyme intermediate. Mouse SERPIN A1 is a serine protease inhibitor whose targets include elastase,plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema orliver disease. Several transcript variants encoding the same protein have been found for this gene.

Specyfikacja/Zawartość:

• Tested Applications: N/A
• Applications: This recombinant protein can be used for biological assays. For research use only.
• Predicted Molecular Weight: 44.4 kD
• Physical state: Lyophilized
• Buffer: Lyophilized from a 0.2 um filtered solution of PBS,pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
• Concentration: N/A
• NCBI official symbol: Serpina1c
• Accession #: Q00896
• Protein GI: N/A
• NCBI gene ID#: 20702
• NCBI official full name: serine (or cysteine) peptidase inhibitor, clade A, member 1C
• NCBI organism: Mus musculus
• Peptide sequence: EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHKVDHHHHHH
• SWISSPROT #: Q00896
• Background Reference 1: N/A
• Background Reference 2: N/A
• Background Reference 3: N/A
• Background Reference 4: N/A
• Background Reference 5: N/A
• Source: Human Cells
• Species: Mouse
• By Source: Human Cells
• By Species: Mouse
• Fusion tag: C-6 His tag
• Sequence: Glu25-Lys413
• Biology activity: N/A
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
  Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.

Wysyłka i przechowywanie:

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

Inne:

Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.