Anti-Toll-like Receptor 4 Antibody

Numer katalogowy: A00017
Producent:

BosterBio

Rozmiar: 200ug
Cena: 2571.40 PLN*
* Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami, aby otrzymać aktualną ofertę.

Opis Produktu:


Goat Polyclonal Toll-like Receptor 4 Antibody. Validated in IF, IHC and tested in Human, Mouse.

Specyfikacja/Zawartość:


  • category: Primary Antibodies
  • gene name: TLR4
  • clonality: Polyclonal
  • clone number: NA
  • concentration: 0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
  • conjugateNo
  • contents: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
  • uniprot id: O00206
  • host: Goat
  • immunogen: Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
  • form: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
  • purification: Epitope-affinity purified IgG.
  • isotype: NA
  • applications: IF, IHC
  • reactivity: Human, Mouse
  • molecular weight: NA

Wysyłka i przechowywanie:


-20°C

0 opinie o Anti-Toll-like Receptor 4 Antibody

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345

czym jest- koronawirus covid-19 corona virus

Koronawirus (COVID-19) – Co musisz wiedzieć?

Koronawirus jest nowym szczepem wirusa oddechowego, który wchodzi w skład dużej rodziny wirusów. Wirus ten powoduje chorobę, która obejmuje zarówno przeziębienie, jak i cięższy zespół oddechowy. Na Bliskim Wschodzie (MERS-CoV) i zespół ciężkiej ostrej niewydolności oddechowej (SARS-CoV). Koronawirus jest największą grupą wirusów należących do rzędu Nidovirales, które obejmują rodziny Coronaviridae, Arteriviridae i Roniviridae. Coronaviridae ma…
Accu-tell COVID-19 igg igm rapid test kasetkowy osocze krew koronawirus

Accu-Tell® COVID-19 IgG/IgM to szybki test kasetkowy (krew pełna / surowica / osocze)

Accu-Tell® COVID-19 to szybki chromatograficzny teste immunologicznym do jakościowego wykrywania przeciwciał IgG i IgM przeciwko SARS-CoV-2 w ludzkiej krwi pełnej, surowicy lub osoczu, jako wsparcie w diagnostyce pierwotnych i wtórnych zakażeń SARS-Cov-2. Test rekacji łańcuchowej polimerazy wykorzystujący kwas nukleinowy - (PCR) jest powszenie uznawanym standardem w diagnozowaniu choroby COVID-19. Jednak obecnie test PCR ma problem…
białka

Białka, czyli główny budulec wszystkiego.

Witamy w trzecim artykule skierowanym do uczniów/studentów. W firmie Gentaur jest to dla nas ważne by oprócz sprzedaży produktów diagnostycznych również edukować innych. W artykułach będą się pojawiać głównie zagadnienia biochemiczne. Możliwe, że również później pojawią się teksty związane z innymi przedmiotami. Razem odkryjemy, że biochemia nie jest aż taka straszna jak się wydaje. Białka…

Toll-like receptor 4 antibody

Nr. kat: 10R-6679

1628.40 PLN

Toll-like receptor 4 antibody

Nr. kat: 10R-6683

1853.80 PLN

Toll-Like Receptor 4 (CD284) Antibody (FITC)

Nr. kat: abx413666-25ug

1251.20 PLN

Toll-Like Receptor 4 (CD284) Antibody (RPE)

Nr. kat: abx413668-100tests

2723.20 PLN

Rat Toll Like Receptor 4 (TLR4) Protein

Nr. kat: 20-abx069367

Prices: 2405.80 PLN, 1122.40 PLN, 6886.20 PLN, 2787.60 PLN, 1766.40 PLN

Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1