Anti-Toll-like Receptor 4 Antibody

Rozmiar: 200ug
Cena: 2571.40 PLN
*Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami aby otrzymać aktualna ofertę.

Numer katalogowy: A00017

Producent:

BosterBio

Opis Produktu:


Goat Polyclonal Toll-like Receptor 4 Antibody. Validated in IF, IHC and tested in Human, Mouse.

Specyfikacja/Zawartość:


  • category: Primary Antibodies
  • gene name: TLR4
  • clonality: Polyclonal
  • clone number: NA
  • concentration: 0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
  • conjugateNo
  • contents: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
  • uniprot id: O00206
  • host: Goat
  • immunogen: Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .
  • form: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
  • purification: Epitope-affinity purified IgG.
  • isotype: NA
  • applications: IF, IHC
  • reactivity: Human, Mouse
  • molecular weight: NA

Wysyłka i przechowywanie:


-20°C

Innowacyjna cytokina pozwoliła chodzić sparaliżowanej myszy laboratorium biotechnologia

Innowacyjna cytokina pozwoliła chodzić sparaliżowanej myszy

Do dzisiaj, paraliż spowodowany uszkodzeniem rdzenia kręgowego był nieodwracalny. Nowym podejściem do leczenia, naukowcom udało się po raz pierwszy sprawić, iż sparaliżowana mysz zaczęła chodzić. Kluczem do tego jest białko hyper-interleukina-6, które stymuluje komórki nerwowe do regeneracji oraz sposób jego podania zwierzętom. Gdy zawodzi przewodzenie Uszkodzenie rdzenia kręgowego spowodowane kontuzjami sportowymi lub wypadkami drogowymi często…
Przeciwciała neutralizujące, chroniące przed patogenami, które wywołują choroby

Przeciwciała neutralizujące, chroniące przed patogenami.

Neutralizujące przeciwciała Przeciwciało neutralizujące to przeciwciało, które chroni komórki przed patogenami wywołującymi choroby. Przeciwciała neutralizujące są wytwarzane naturalnie przez organizm jako część układu odpornościowego. Są wytwarzane podczas infekcji lub przez szczepionki przeciwko infekcji (Zoppi i wsp., 2020). Przeciwciała mogą zapewnić trwałą odporność na niektóre infekcje i mogą być używane do określenia, czy dana osoba rozwinęła…
Białka do badań COVID-19

Białka do badań COVID-19

Koronawirusy to otoczkowe, niesegmentowane wirusy RNA o pozytywnym sensie, infekujące ludzi, ssaki i ptaki. Cząsteczki wirusa koronawirusa zawierają cztery główne białka strukturalne. Są to białka piku (S), błony (M), otoczki (E) i nukleokapsydu (N), z których wszystkie są zakodowane na końcu 3 'genomu wirusowego. Obecnie nie ma dostępnych szczepionek ani leków przeciwwirusowych do zapobiegania lub…

Related Products:

Toll-like receptor 4 antibody

Nr. kat: 10R-6679

1628.40 PLN

Toll-like receptor 4 antibody

Nr. kat: 10R-6683

1853.80 PLN

Toll Like Receptor 4 (TLR4) Antibody (APC)

Nr. kat: 20-abx270699

Prices: 3238.40 PLN, 3813.40 PLN, 1702.00 PLN, 6118.00 PLN, 2277.00 PLN

Toll Like Receptor 4 (TLR4) Antibody (PE)

Nr. kat: 20-abx270889

Prices: 2787.60 PLN, 3302.80 PLN, 1508.80 PLN, 5221.00 PLN, 2019.40 PLN

Mouse Toll Like Receptor 4 (TLR4) Protein

Nr. kat: 20-abx069366

Prices: 2658.80 PLN, 1186.80 PLN, 7912.00 PLN, 3174.00 PLN, 1955.00 PLN

Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1