Amphiphysin Blocking Peptide
Gentaur
Mogą Cię zainteresować
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-5048
Specyfikacja/Zawartość:
- Category: Blocking Peptides
- Research Area: Signal Transduction
- Residues: ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVV
- Type: Synthetic
- Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
- Applications: WB, IHC
Wysyłka i przechowywanie:
- Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
0 opinie o Amphiphysin Blocking Peptide