Monoclonal antibody for SUR1 and SUR2B

Monoclonal antibody for SUR1 and SUR2B

Numer katalogowy: 400-SMC-432D-STR
Sprzedawca:

Stressmarq Gentaur

Rozmiar: 0.1mg
Cena: 2239.08 PLN*
Lorem ipsum asdokfopdskaf
Monoclonal antibody for SUR1 and SUR2B
Monoclonal antibody for SUR1 and SUR2B

Numer kat.: / Rozmiar: / Cena: PLN

* Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami, aby otrzymać aktualną ofertę.

Opis Produktu:


A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Dodatkowe informacje:


Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

Wysyłka i przechowywanie:


  • Shipped on ice packs at +4ºC . Upon receiving the antibody store it at -20ºC.
  • The gross weight of the package is 1.4 kg. and the net weight of the product is 0.1 grams.
  • The item is not hazardous according to both ADR and UN. Its tariff code is 3002.15.0000 (Immunological products, put up in measured doses or in forms or packings for retail sale). The UNSPSC code of the product is 12352203 (Antibodies).

Inne:


This product is not for human or animal treatment or consumption. Not for use in diagnostics or therapeutics. For in vitro research use only.

0 opinie o Monoclonal antibody for SUR1 and SUR2B

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345

Wąsopad – listopad miesiącem świadomości męskich nowotworów

Wąsopad – listopad miesiącem świadomości męskich nowotworów

Co roku miesiąc listopad przypomina nam dzięki akcji „Movember” (na polski „Wąsopad”) o tym jak ważna jest profilaktyka męskich nowotworów. Dzięki temu wydarzeniu wielu mężczyzn ma możliwość dowiedzenia się jak ważne są badania profilaktyczne w ich przypadku. Lecz z jakimi dokładnie chorobami związana jest ta akcja? Oraz jakie badania należy wykonać? O tym dowiedzą się…
Przeciwciała neutralizujące, chroniące przed patogenami, które wywołują choroby

Przeciwciała neutralizujące, chroniące przed patogenami.

Neutralizujące przeciwciała Przeciwciało neutralizujące to przeciwciało, które chroni komórki przed patogenami wywołującymi choroby. Przeciwciała neutralizujące są wytwarzane naturalnie przez organizm jako część układu odpornościowego. Są wytwarzane podczas infekcji lub przez szczepionki przeciwko infekcji (Zoppi i wsp., 2020). Przeciwciała mogą zapewnić trwałą odporność na niektóre infekcje i mogą być używane do określenia, czy dana osoba rozwinęła…
Choroby zakaźne

Choroby zakaźne – Wirusowe

Ospa wietrzna Jest to choroba zakaźna wywołana przez wirusy ospy wietrznej i półpaśca. Ospa wietrzna występuje zazwyczaj u dzieci i ma łagodny przebieg. U młodzieży i dorosłych ma nieco cięższy przebieg i może spowodować powikłania. Choroba ta wywołana jest przez wirus przenoszony drogą kropelkową lub bezpośrednio przez korzystanie z tych samych rzeczy z których korzysta…

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A390

2256.00 PLN

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A488

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-A700

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-ALP

2216.52 PLN

Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1