Monoclonal antibody for SUR1 and SUR2B

Monoclonal antibody for SUR1 and SUR2B

Numer katalogowy: 400-SMC-432D-RPE
Sprzedawca:

Stressmarq Gentaur

Rozmiar: 0.1mg
Cena: 2233.44 PLN*
Lorem ipsum asdokfopdskaf
Monoclonal antibody for SUR1 and SUR2B
Monoclonal antibody for SUR1 and SUR2B

Numer kat.: / Rozmiar: / Cena: PLN

* Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami, aby otrzymać aktualną ofertę.

Opis Produktu:


A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Dodatkowe informacje:


Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

Wysyłka i przechowywanie:


  • Shipped on ice packs at +4ºC . Upon receiving the antibody store it at -20ºC.
  • The gross weight of the package is 1.4 kg. and the net weight of the product is 0.1 grams.
  • The item is not hazardous according to both ADR and UN. Its tariff code is 3002.15.0000 (Immunological products, put up in measured doses or in forms or packings for retail sale). The UNSPSC code of the product is 12352203 (Antibodies).

Inne:


This product is not for human or animal treatment or consumption. Not for use in diagnostics or therapeutics. For in vitro research use only.

0 opinie o Monoclonal antibody for SUR1 and SUR2B

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345

Czym jest wirus?

Czym jest wirus?

Po łacinie VIRUS oznacza jad. To bardzo trafne określenie ponieważ jest to coś, co potrafi zrobić bardzo dużo złego dla naszego organizmu. Wirusy potrafią mutować i bardzo szybko się rozmnażać w organizmie. Są to bardzo, bardzo małe cząsteczki mniejsze od bakterii. Zbuntowane są z kwasów nuklidowych i białka. Nie mają żadnego kształtu i atakując dopasowują…
Q&A na temat koronawirus (COVID-19) #zostańwdomu Czym jest koronawirus? Czym jest COVID-19?

Q&A na temat koronawirus (COVID-19)

Czym jest koronawirus? Koronawirusy to duża rodzina wirusów, które mogą powodować choroby u zwierząt i ludzi. U ludzi wiadomo, że kilka wirusów z grupy koronawirusów powoduje infekcje dróg oddechowych, od zwykłego przeziębienia po cięższe choroby, takie jak zespół oddechowy Bliskiego Wschodu (MERS) i zespół ciężkiej ostrej niewydolności oddechowej (SARS). Ostatnio odkryty koronawirus powoduje chorobę koronawirusa…
Co to jest Małpia ospa (ang. monkeypox)? – znaczny wzrost liczby zachorowań w Europie i USA

Co to jest Małpia ospa (ang. monkeypox)? – znaczny wzrost liczby zachorowań w Europie i Ameryce

Światowa Organizacja Zdrowia zidentyfikowała około 80 przypadków ospy małpiej na całym świecie i około 50 innych podejrzeń zakażeń. Jeden z wiodących lekarzy powiedział stacji Sky News, że w ciągu najbliższego tygodnia Wielka Brytania stanie w obliczu "znacznego wzrostu" liczby zachorowań. Ospa małpia, która jest powiązana z wyeliminowanym już wirusem ospy wietrznej, występuje endemicznie w części…

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A390

2256.00 PLN

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A488

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-A700

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-ALP

2216.52 PLN

Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1