Monoclonal antibody for SUR1 and SUR2B

Monoclonal antibody for SUR1 and SUR2B

Numer katalogowy: 400-SMC-432D-PCP
Sprzedawca:

Stressmarq Gentaur

Rozmiar: 0.1mg
Cena: 2244.72 PLN*
Lorem ipsum asdokfopdskaf
Monoclonal antibody for SUR1 and SUR2B
Monoclonal antibody for SUR1 and SUR2B

Numer kat.: / Rozmiar: / Cena: PLN

* Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami, aby otrzymać aktualną ofertę.

Opis Produktu:


A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Dodatkowe informacje:


Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

Wysyłka i przechowywanie:


  • Shipped on ice packs at +4ºC . Upon receiving the antibody store it at -20ºC.
  • The gross weight of the package is 1.4 kg. and the net weight of the product is 0.1 grams.
  • The item is not hazardous according to both ADR and UN. Its tariff code is 3002.15.0000 (Immunological products, put up in measured doses or in forms or packings for retail sale). The UNSPSC code of the product is 12352203 (Antibodies).

Inne:


This product is not for human or animal treatment or consumption. Not for use in diagnostics or therapeutics. For in vitro research use only.

0 opinie o Monoclonal antibody for SUR1 and SUR2B

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345

Wąsopad – listopad miesiącem świadomości męskich nowotworów

Wąsopad – listopad miesiącem świadomości męskich nowotworów

Co roku miesiąc listopad przypomina nam dzięki akcji „Movember” (na polski „Wąsopad”) o tym jak ważna jest profilaktyka męskich nowotworów. Dzięki temu wydarzeniu wielu mężczyzn ma możliwość dowiedzenia się jak ważne są badania profilaktyczne w ich przypadku. Lecz z jakimi dokładnie chorobami związana jest ta akcja? Oraz jakie badania należy wykonać? O tym dowiedzą się…
Wysokie zapotrzebowanie na końcówki filtrujące - Filter tips

Wysokie zapotrzebowanie na końcówki filtrujące – Filter tips

Czy tej zimy nie będzie badań diagnostycznych z wykorzystaniem technik PCR? Podobnie jak w latach 90tych, dziś świat może mieć problemy z badaniami PCR z powodu braku końcówek z filtrem do pipet automatycznych (filtertip). Ze względu na zwiększone użycie procedury PCR, na całym świecie występuje niedobór końcówek filtrujących (1000ul i 1250ul PCR do amplifikacji DNA).…
Małpia ospa (ang. monkeypox) – Mapa na żywo

Małpia ospa (ang. monkeypox) – Mapa na żywo

Co to jest Małpia ospa (ang. monkeypox)? – znaczny wzrost liczby zachorowań w Europie i USA Światowa Organizacja Zdrowia zidentyfikowała około 80 przypadków ospy małpiej na całym świecie i około 50 innych podejrzeń zakażeń. Jeden z wiodących lekarzy powiedział stacji Sky News, że w ciągu najbliższego tygodnia Wielka Brytania stanie w obliczu "znacznego wzrostu" liczby…

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A390

2256.00 PLN

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A488

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-A700

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-ALP

2216.52 PLN

Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1