Monoclonal antibody for SUR1 and SUR2B

Monoclonal antibody for SUR1 and SUR2B

Numer katalogowy: 400-SMC-432D-DY633
Sprzedawca:

Stressmarq Gentaur

Rozmiar: 0.1mg
Cena: 2193.96 PLN*
Lorem ipsum asdokfopdskaf
Monoclonal antibody for SUR1 and SUR2B
Monoclonal antibody for SUR1 and SUR2B

Numer kat.: / Rozmiar: / Cena: PLN

* Cena orientacyjna netto, bez kosztów transportu. Skontaktuj się z nami, aby otrzymać aktualną ofertę.

Opis Produktu:


A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633.

Dodatkowe informacje:


Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

Wysyłka i przechowywanie:


  • Shipped on ice packs at +4ºC . Upon receiving the antibody store it at -20ºC.
  • The gross weight of the package is 1.4 kg. and the net weight of the product is 0.1 grams.
  • The item is not hazardous according to both ADR and UN. Its tariff code is 3002.15.0000 (Immunological products, put up in measured doses or in forms or packings for retail sale). The UNSPSC code of the product is 12352203 (Antibodies).

Inne:


This product is not for human or animal treatment or consumption. Not for use in diagnostics or therapeutics. For in vitro research use only.

0 opinie o Monoclonal antibody for SUR1 and SUR2B

Dodaj opinię

Twój adres e-mail niie będzie upubliczniony.

12345

wplyw korona wirusa na globalny rynek niski kurs dolara covid-19 coronavirus

Koronawirus i jego konsekwencje

Choroba wywołana przez koronawirus została ostatnio nazwana przez WHO, czyli Światową Organizację Zdrowia Covid-19. Nazwa pochodzi od angielskiego słowa „corona” (krąg światła widziany czasami wokół księżyca lub słońca w zaćmieniu) , 'virus' (wirus) i 'disease' (choroba) Rok 2019 uznaje się za rok w którym wirus się pojawił. Liczba ofiar śmiertelnych wzrasta. W Chinach odnotowano ponad…
Małpia ospa (ang. monkeypox) – Mapa na żywo

Małpia ospa (ang. monkeypox) – Mapa na żywo

Co to jest Małpia ospa (ang. monkeypox)? – znaczny wzrost liczby zachorowań w Europie i USA Światowa Organizacja Zdrowia zidentyfikowała około 80 przypadków ospy małpiej na całym świecie i około 50 innych podejrzeń zakażeń. Jeden z wiodących lekarzy powiedział stacji Sky News, że w ciągu najbliższego tygodnia Wielka Brytania stanie w obliczu "znacznego wzrostu" liczby…
Kim jest i czym się zajmuje laborant - labo

Kim jest i czym się zajmuje laborant?

Dowiedz się, kogo nazywamy laborantem, z jaką ścieżką kształcenia wiąże się ten zawód, jakie są statystyczne zarobki laborantów i jak wygląda ich codzienna praca. Jak wygląda praca laboranta?   Laborant to potoczne określenie nazywające pracownika laboratorium, najczęściej diagnostę laboratoryjnego. Osoba na tym stanowisku zajmuje się pobieraniem materiału biologicznego, badaniem i analizowaniem go, dzięki czemu przyczynia…

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A390

2256.00 PLN

Monoclonal antibody for SUR1 and SUR2B

Nr. kat: SMC-432D-A488

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-A700

2250.36 PLN

Monoclonal antibody for SUR1

Nr. kat: SMC-409D-ALP

2216.52 PLN

Masz pytanie? Czy chcesz zamówić?
Skontaktuj się z nami. Jeśli masz pytanie o konkretny produkt podaj go w formularzu kontaktowym.

Zobacz również

1